(link: https://lnkd.in/fqcx7jA) drsaraswatpathlabs.com) or call on 8979128540
dr.vikram saraswat (MD Pathology)
drvikramsaraswatdrsaraswatpathlabs #dr pathology md link call
Thyroid Disorder And Its Symptoms and Signs.
THYROID TEST AND ITS RESULTS WHAT IS THYROID DISEASES Thyroid disease is a common problem that can cause symptoms because of over- or under-function of the thyroid gland. The thyroid gland is an essential organ for producing thyroid hormones, which maintain our body metabolism. The thyroid gland is located in the front of the neck below Adam's apple and the gland is a butterfly-shaped organ. Its job is to take iodine from the blood and combine it with an amino acid to form thyroid hormones. Thyroid The two most important thyroid hormones are thyroid-stimulating hormone (TSH, thyrotropin) and thyroxine (T4) and triiodothyronine (T3), which account for 99.9% and 0.1% of thyroid hormones present in the blood respectively. Blood tests to measure TSH, T4, T3 and Free T4 are readily available and widely used. Thyroid-Stimulating Hormone (TSH) The hypothalamus, located in the ...

Comments
Post a Comment